Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MAGEB2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | MAGEB2 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MAGEB2 Polyclonal specifically detects MAGEB2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
MAGEB2 | |
Polyclonal | |
Rabbit | |
Human | |
Cancer/testis antigen 3.2, cancer/testis antigen family 3, member 2, CT3.2MAGE-B2 antigen, DAM6MAGE XP-2 antigen, DSS/AHC critical interval MAGE superfamily 6, DSS-AHC critical interval MAGE superfamily 6, MAGE-XP-2, melanoma antigen family B, 2, melanoma-associated antigen B2, MGC26438 | |
MAGEB2 | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
4113 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFP | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title