Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579621

Invitrogen™ MAK Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579621
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579621 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579621 Supplier Invitrogen™ Supplier No. PA579621
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HepG2 whole cell, human MCF-7 whole cell.

The product of this gene is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. It is expressed almost exclusively in the testis, primarily in germ cells. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. There is, however, a study of the mouse homolog that has identified high levels of expression in developing sensory epithelia so its function may be more generalized.
TRUSTED_SUSTAINABILITY

Specifications

Antigen MAK
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene MAK
Gene Accession No. P20794
Gene Alias A930010O05Rik; dJ417M14.2; MAK; male germ cell associated kinase; male germ cell-associated kinase; male germ cell-associated kinase retinal-enriched isoform; protein kinase RCK; Rck; RP62; serine/threonine protein kinase MAK; serine/threonine-protein kinase MAK; testicular secretory protein Li 28; Unknown (protein for MGC:134523)
Gene Symbols MAK
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human MAK (588-623aa RTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4117
Target Species Human
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.