Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MAML2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310453100UL
Description
MAML2 Polyclonal specifically detects MAML2 in Mouse samples. It is validated for Western Blot.Specifications
MAML2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
DKFZp686N0150, KIAA1819MGC176701, mam-2, MAM2, MAM-3, MAM3MLL-MAML2, mastermind (Drosophila)-like 2, mastermind-like 2 (Drosophila), mastermind-like protein 2 | |
The immunogen is a synthetic peptide directed towards the c terminal region of human MAML2 (XP_486185). Peptide sequence PSPLGANNGNNVATFGAGSAGSSQQLRPNLAHSLSGMSAQRSSTVMITAN | |
100 μg | |
Primary | |
Mouse | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
84441 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction