MAN2A2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP174213

Catalog No. NBP174213

Description

MAN2A2 Polyclonal specifically detects MAN2A2 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: MAN2A2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: alpha-mannosidase 2x, alpha-mannosidase IIx, MAN IIx, MANA2X, mannosidase, alpha type II-X, mannosidase, alpha, class 2A, member 2, mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase, manosidase, alpha-, type II, isozyme X
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4122
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8BRK9
• Gene Symbols: MAN2A2
• Immunogen: Synthetic peptides corresponding to the N terminal of mouse Man2a2 (NP_766491). Immunizing peptide sequence PQDCQFALGGRGQKPELQMLTVSEDLPFDNVEGGVWRQGFDISYSPNDWD.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%; Equine: 92%; Pig: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG