Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MAN2A2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17421320UL
Description
MAN2A2 Polyclonal specifically detects MAN2A2 in Mouse samples. It is validated for Western Blot.Specifications
MAN2A2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Q8BRK9 | |
MAN2A2 | |
Synthetic peptides corresponding to the N terminal of mouse Man2a2 (NP_766491). Immunizing peptide sequence PQDCQFALGGRGQKPELQMLTVSEDLPFDNVEGGVWRQGFDISYSPNDWD. | |
20 μL | |
Primary | |
Mouse | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
alpha-mannosidase 2x, alpha-mannosidase IIx, MAN IIx, MANA2X, mannosidase, alpha type II-X, mannosidase, alpha, class 2A, member 2, mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase, manosidase, alpha-, type II, isozyme X | |
Rabbit | |
Affinity Purified | |
RUO | |
4122 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction