Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MAN2A2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | MAN2A2 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17421320
|
Novus Biologicals
NBP17421320UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP174213
|
Novus Biologicals
NBP174213 |
100 μL |
Each for $487.50
|
|
|||||
Description
MAN2A2 Polyclonal specifically detects MAN2A2 in Mouse samples. It is validated for Western Blot.Specifications
| MAN2A2 | |
| Western Blot | |
| Unconjugated | |
| RUO | |
| alpha-mannosidase 2x, alpha-mannosidase IIx, MAN IIx, MANA2X, mannosidase, alpha type II-X, mannosidase, alpha, class 2A, member 2, mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase, manosidase, alpha-, type II, isozyme X | |
| MAN2A2 | |
| IgG |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Rabbit | |
| Q8BRK9 | |
| 4122 | |
| Synthetic peptides corresponding to the N terminal of mouse Man2a2 (NP_766491). Immunizing peptide sequence PQDCQFALGGRGQKPELQMLTVSEDLPFDNVEGGVWRQGFDISYSPNDWD. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title