Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89934513

MAP3K1 Mouse anti-Human, Clone: 2F6, Abnova™

Catalog No. 89934513 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-934-513 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-934-513 Supplier Abnova Corporation Supplier No. MAB13347
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against partial recombinant human MAP3K1.

MAP3K, or MEK kinase, is a serine/threonine kinase that occupies a pivotal role in a network of phosphorylating enzymes integrating cellular responses to a number of mitogenic and metabolic stimuli, including insulin (MIM 176730) and many growth factors.[supplied by OMIM]

Sequence: SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTPVEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK

Specifications

Antigen MAP3K1
Applications Flow Cytometry, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Classification Monoclonal
Clone 2F6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against partial recombinant human MAP3K1.
Dilution Flow Cytometry (0.5-1 ug/106 cells in 0.1 mL) Immunofluorescence (1-2 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (0.5-1 ug/mL) Western Blot (0.5-1 ug/mL) The optimal working dilution should be determ
Formulation In 10mM PBS (0.05% BSA, 0.05% sodium azide).
Gene Alias MAPKKK1/MEKK/MEKK1
Gene Symbols MAP3K1
Host Species Mouse
Immunogen Recombinant protein corresponding to amino acids 1077-1176 of human MAP3K1.
Purification Method Protein A/G purification
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4214
Target Species Human
Content And Storage Store at 4°C.
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.