Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MAP3K1 Mouse anti-Human, Clone: 2F6, Abnova™

Mouse monoclonal antibody raised against partial recombinant human MAP3K1.

Manufacturer:  Abnova Corporation MAB13347

Catalog No. 89-934-513


Add to cart

Description

Description

MAP3K, or MEK kinase, is a serine/threonine kinase that occupies a pivotal role in a network of phosphorylating enzymes integrating cellular responses to a number of mitogenic and metabolic stimuli, including insulin (MIM 176730) and many growth factors.[supplied by OMIM]

Sequence: SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTPVEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK
Specifications

Specifications

MAP3K1
2F6
Mouse monoclonal antibody raised against partial recombinant human MAP3K1.
In 10mM PBS (0.05% BSA, 0.05% sodium azide).
MAPKKK1/MEKK/MEKK1
Mouse
IgG2a, kappa
100 ug
Store at 4°C.
Monoclonal
Human
Flow Cytometry, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Unconjugated
Flow Cytometry (0.5-1 ug/106 cells in 0.1 mL) Immunofluorescence (1-2 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (0.5-1 ug/mL) Western Blot (0.5-1 ug/mL) The optimal working dilution should be determ
Liquid
MAP3K1
Recombinant protein corresponding to amino acids 1077-1176 of human MAP3K1.
Protein A/G purification
RUO
Primary
4214
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit