Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MAP4K2 Antibody, Novus Biologicals™

MAP4K2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP1588520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1588520 20 μL
NBP158851 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1588520 Supplier Novus Biologicals Supplier No. NBP15885120UL

Description

Rabbit Polyclonal Antibody

MAP4K2 Polyclonal specifically detects MAP4K2 in Human samples. It is validated for Western Blot.

Specifications

Antigen MAP4K2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q12851
Gene Alias B lymphocyte serine/threonine protein kinase, B lymphocyte serine/threonine-protein kinase, BL44, EC 2.7.11, EC 2.7.11.1, GC kinase, GCKMEK kinase kinase 2, Germinal center kinase, germinal centre kinase (GC kinase), MAPK/ERK kinase kinase kinase 2, mitogen-activated protein kinase kinase kinase kinase 2, Rab8 interacting protein, Rab8-interacting protein, RAB8IPMEKKK 2
Gene Symbols MAP4K2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to MAP4K2(mitogen-activated protein kinase kinase kinase kinase 2) The peptide sequence was selected from the N terminal of MAP4K2. Peptide sequence TVTSELAAVKIVKLDPGDDISSLQQEITILRECRHPNVVAYIGSYLRNDR.
Molecular Weight of Antigen 91 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5871
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.