Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MAP6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | MAP6 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MAP6 Polyclonal specifically detects MAP6 in Human samples. It is validated for Western Blot.Specifications
MAP6 | |
Polyclonal | |
Rabbit | |
NP_149052 | |
4135 | |
Synthetic peptide directed towards the N terminal of human MAP6. Peptide sequence RPEPSCRPRSEYQPSDAPFERETQYQKDFRAWPLPRRGDHPWIPKPVQIS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
microtubule-associated protein 6 | |
MAP6 | |
IgG | |
86 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title