Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MAP7D1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | MAP7D1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MAP7D1 Polyclonal specifically detects MAP7D1 in Human, Mouse samples. It is validated for Western Blot, Knockdown Validated.Specifications
MAP7D1 | |
Polyclonal | |
Rabbit | |
MAP7 domain containing 1 | |
MAP7D1 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
55700 | |
Synthetic peptides corresponding to MAP7D1(MAP7 domain containing 1) The peptide sequence was selected from the N terminal of MAP7D1. Peptide sequence RRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQ. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title