MAPK1IP1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP188420

Catalog No. NBP188420

Description

MAPK1IP1L Polyclonal specifically detects MAPK1IP1L in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MAPK1IP1L
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: c14_5346, C14orf32, chromosome 14 open reading frame 32, MAPK-interacting and spindle-stabilizing protein, MAPK-interacting and spindle-stabilizing protein-like, MGC23138, MISS, mitogen activated protein kinase 1 interacting protein 1-like, mitogen-activated protein kinase 1 interacting protein 1-like, Mitogen-activated protein kinase 1-interacting protein 1-like
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 93487
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: MAPK1IP1L
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:APPVPWGTVPPGAWGPPAPYPAPTGSYPTPGLYPTPSNPFQVPSGPSGAPPMPGG
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only