MARCH1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191637

Catalog No. NBP191637

Description

44256 Polyclonal specifically detects 44256 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MARCH1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q8TCQ1
• Gene Symbols: 43160
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KVYVQLWRRLKAYNRVIFVQNCPDTAKKLEKNFSCNVNTDIKDAVVVPVPQTGANSLPSAEGG
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: E3 ubiquitin-protein ligase MARCH1, EC 6.3.2, EC 6.3.2.-, MARCH-IDKFZp564M1682, membrane-associated ring finger (C3HC4) 1, Membrane-associated RING finger protein 1, Membrane-associated RING-CH protein I, RING finger protein 171, RNF171FLJ20668
• Host Species: Rabbit
• Molecular Weight of Antigen: 32 kDa
• Quantity: 0.1 mL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 55016
• Target Species: Human
• Isotype: IgG

For Research Use Only