MARCH2, Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit Polyclonal Antibody

Supplier:  Abnova Corporation PAB31442

Catalog No. 89-998-245

Description

Sequence: RYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV

Specifications

• Antigen: MARCH2
• Classification: Polyclonal
• Dilution: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
• Gene: membrane-associated ring finger (C3HC4) 2
• Gene Symbols: MARCH2
• Immunogen: Recombinant protein corresponding to human MARCH2.
• Regulatory Status: RUO
• Gene ID (Entrez): 51257
• Content And Storage: Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Conjugate: Unconjugated
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
• Gene Alias: HSPC240/MARCH-II/RNF172
• Host Species: Rabbit
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG