Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MARCH4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15973620UL
Description
44259 Polyclonal specifically detects 44259 in Human samples. It is validated for Western Blot.Specifications
MARCH4 | |
Polyclonal | |
Western Blot | |
Q9P2E8 | |
43163 | |
Synthetic peptides corresponding to MARCH4(membrane-associated ring finger (C3HC4) 4) The peptide sequence was selected form the N terminal of 40241. Peptide sequence GLLKCRCRMLFNDLKVFLLRRPPQAPLPMHGDPQPPGLAANNTLPALGAG. | |
20 μL | |
Zinc Finger | |
57574 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
EC 6.3.2.-, KIAA1399E3 ubiquitin-protein ligase MARCH4, MARCH-IVMGC104908, membrane-associated ring finger (C3HC4) 4, Membrane-associated RING finger protein 4, Membrane-associated RING-CH protein IV, RNF174RING finger protein 174 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction