MARCH5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25677925UL

Catalog No. NB403613

Description

44260 Polyclonal specifically detects 44260 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: MARCH5
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: E3 ubiquitin-protein ligase MARCH5, EC 6.3.2, EC 6.3.2.-, FLJ20445, MARCH-VRNF153, membrane-associated ring finger (C3HC4) 5, Membrane-associated RING finger protein 5, Membrane-associated RING-CH protein V, Mitochondrial ubiquitin ligase, RING finger protein 153MITOL
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: 43164
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PDQALQQMLDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVYVLDLA
• Quantity: 25 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 54708
• Target Species: Human
• Form: Purified

For Research Use Only