MARCH5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159585

Catalog No. NBP159585

Description

44260 Polyclonal specifically detects 44260 in Human samples. It is validated for Western Blot, Immunoblotting, Knockout Validated.

Specifications

• Antigen: MARCH5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: E3 ubiquitin-protein ligase MARCH5, EC 6.3.2, EC 6.3.2.-, FLJ20445, MARCH-VRNF153, membrane-associated ring finger (C3HC4) 5, Membrane-associated RING finger protein 5, Membrane-associated RING-CH protein V, Mitochondrial ubiquitin ligase, RING finger protein 153MITOL
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Green puffer: 100%; Green monkey; Rainbow trout: 100%; Atlantic salmon: 100%; Western clawed frog: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunoblot, Immunoassay
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunoblotting, Knockout Validated
• Gene Accession No.: Q9NX47
• Gene Symbols: 43164
• Immunogen: Synthetic peptides corresponding to MARCH5(membrane-associated ring finger (C3HC4) 5) The peptide sequence was selected form the N terminal of 40242. Peptide sequence CRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVY.
• Quantity: 100 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 54708
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution. Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.