Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MARCH5 Antibody, Novus Biologicals™
SDP

Catalog No. NBP159585 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159585 100 μL
NBP15958520 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP159585 Supplier Novus Biologicals Supplier No. NBP159585
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

44260 Polyclonal specifically detects 44260 in Human samples. It is validated for Western Blot, Immunoblotting, Knockout Validated.

Specifications

Antigen MARCH5
Applications Western Blot, Immunoblot, Immunoassay
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunoblotting, Knockout Validated
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9NX47
Gene Alias E3 ubiquitin-protein ligase MARCH5, EC 6.3.2, EC 6.3.2.-, FLJ20445, MARCH-VRNF153, membrane-associated ring finger (C3HC4) 5, Membrane-associated RING finger protein 5, Membrane-associated RING-CH protein V, Mitochondrial ubiquitin ligase, RING finger protein 153MITOL
Gene Symbols 43164
Host Species Rabbit
Immunogen Synthetic peptides corresponding to MARCH5(membrane-associated ring finger (C3HC4) 5) The peptide sequence was selected form the N terminal of 40242. Peptide sequence CRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVY.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 54708
Test Specificity Expected identity based on immunogen sequence: Green puffer: 100%; Green monkey; Rainbow trout: 100%; Atlantic salmon: 100%; Western clawed frog: 100%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution. Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.