Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MARCH5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen MARCH5
Immunogen Synthetic peptides corresponding to MARCH5(membrane-associated ring finger (C3HC4) 5) The peptide sequence was selected form the N terminal of 40242. Peptide sequence CRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVY.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15958520 View Documents Novus BiologicalsSupplier Diversity Partner
NBP15958520UL
20ul Each for $149.00
Add to cart
 
NBP159585 View Documents Novus BiologicalsSupplier Diversity Partner
NBP159585
100 ul Each for $329.00
Add to cart
 
Description

Description

MARCH5 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

MARCH5
Rabbit
Polyclonal
Unconjugated
54708
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to MARCH5(membrane-associated ring finger (C3HC4) 5) The peptide sequence was selected form the N terminal of 40242. Peptide sequence CRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVY.
Primary
IgG
E3 ubiquitin-protein ligase MARCH5, EC 6.3.2, EC 6.3.2.-, FLJ20445, MARCH-VRNF153, membrane-associated ring finger (C3HC4) 5, Membrane-associated RING finger protein 5, Membrane-associated RING-CH protein V, Mitochondrial ubiquitin ligase, RING finger protein 153MITOL
PBS & 2% Sucrose. with No Preservative
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit