Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MARCH5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $501.50
Specifications
| Antigen | MARCH5 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15958520
|
Novus Biologicals
NBP15958520UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP159585
|
Novus Biologicals
NBP159585 |
100 μL |
Each for $501.50
|
|
|||||
Description
44260 Polyclonal specifically detects 44260 in Human samples. It is validated for Western Blot, Immunoblotting, Knockout Validated.Specifications
| MARCH5 | |
| Unconjugated | |
| RUO | |
| Q9NX47 | |
| 54708 | |
| Synthetic peptides corresponding to MARCH5(membrane-associated ring finger (C3HC4) 5) The peptide sequence was selected form the N terminal of 40242. Peptide sequence CRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVY. | |
| Primary |
| Polyclonal | |
| Rabbit | |
| Zinc Finger | |
| E3 ubiquitin-protein ligase MARCH5, EC 6.3.2, EC 6.3.2.-, FLJ20445, MARCH-VRNF153, membrane-associated ring finger (C3HC4) 5, Membrane-associated RING finger protein 5, Membrane-associated RING-CH protein V, Mitochondrial ubiquitin ligase, RING finger protein 153MITOL | |
| 43164 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title