Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MARCO Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $524.00
Specifications
| Antigen | MARCO |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15954320
|
Novus Biologicals
NBP15954320UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP159543
|
Novus Biologicals
NBP159543 |
100 μL |
Each for $524.00
|
|
|||||
Description
MARCO Polyclonal specifically detects MARCO in Human samples. It is validated for Western Blot.Specifications
| MARCO | |
| Polyclonal | |
| Rabbit | |
| Human | |
| macrophage receptor with collagenous structureSCARA2Scavenger receptor class A member 2, member 2 | |
| MARCO | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9UEW3 | |
| 8685 | |
| Synthetic peptides corresponding to MARCO(macrophage receptor with collagenous structure) The peptide sequence was selected from the N terminal of MARCO. Peptide sequence QARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title