MAS1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18515725UL

Catalog No. NB432349

Description

MAS1L Polyclonal specifically detects MAS1L in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MAS1L
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000
• Gene Alias: dJ994E9.2, MAS1 oncogene-like, MAS1-like, MAS-L, MAS-R, mas-related G protein-coupled MRG, mas-related G-protein coupled receptor MRG, MRGMGC119987
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: MAS1L
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ICWFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVSQLCGVFLQNETNETIHMQMSMAVGQQALPLNIIA
• Quantity: 25ul
• Research Discipline: GPCR
• Gene ID (Entrez): 116511
• Target Species: Human
• Isotype: IgG

For Research Use Only