Invitrogen™ ATOH1 Polyclonal Antibody

Catalog No.	Quantity
PIPA595450	100 μg

Catalog No. PIPA595450 Supplier Invitrogen™ Supplier No. PA595450

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HL-60 whole cell, rat PC-12 whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The Drosophila atonal gene produces a protein with basic helix loop helix (bHLH) domains that plays an essential role in the development of the Drosophila nervous system. Mammalian atonal homolog 1 (MATH-1) is a helix-loop-helix (HLH) transcription factor that is structurally homologous to the product of the Drosophila proneural gene atonal. MATH-1, so known as Atoh1, Ath1 or HATH-1, is a 351 amino acid protein with an atonal-related basic HLH domain. In mice, expression of MATH-1 takes place by embryonic day 9. 5 and initially localizes to the cranial ganglions and the dorsal part of the central nervous system. Prominent expression of MATH-1 is in the dorsal part of the central nervous system but becomes restricted to the external granular layer of the cerebellum by day 18 and is undetectable in the adult nervous system. It is suggested that MATH-1 may play a role in the differentiation of subsets of neural cells by activating E box-dependent transcription.

Specifications

• Antigen: ATOH1
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 4mg trehalose and no preservative
• Gene: Atoh1
• Gene Accession No.: Q92858
• Gene Alias: ATH1; Atoh1; atonal bHLH transcription factor 1; atonal homolog 1; atonal homolog 1 (Drosophila); atonal homolog bHLH transcription factor 1; BHLHA14; Class A basic helix-loop-helix protein 14; H MATH-1; Hath1; Helix-loop-helix protein hATH-1; helix-loop-helix protein mATH-1; Math1; MATH-1; Protein atonal homolog 1; RGD1565171
• Gene Symbols: Atoh1
• Host Species: Rabbit
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MATH1/HATH1 (1-30aa MSRLLHAEEWAEVKELGDHHRQPQPHHLPQ).
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 474, 500156
• Target Species: Human, Rat
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov