Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Matrilin-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | Matrilin-1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Matrilin-1 Polyclonal specifically detects Matrilin-1 in Human samples. It is validated for Western Blot.Specifications
| Matrilin-1 | |
| Polyclonal | |
| Rabbit | |
| P21941 | |
| 4146 | |
| Synthetic peptides corresponding to MATN1(matrilin 1, cartilage matrix protein) The peptide sequence was selected from the middle region of MATN1 (NP_002370). Peptide sequence KYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| cartilage matrix protein, matrilin 1, cartilage matrix protein | |
| MATN1 | |
| IgG | |
| 54 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title