Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Matrilin-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Matrilin-1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Matrilin-1 Polyclonal specifically detects Matrilin-1 in Human samples. It is validated for Western Blot.Specifications
Matrilin-1 | |
Polyclonal | |
Rabbit | |
P21941 | |
4146 | |
Synthetic peptides corresponding to MATN1(matrilin 1, cartilage matrix protein) The peptide sequence was selected from the middle region of MATN1 (NP_002370). Peptide sequence KYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
cartilage matrix protein, matrilin 1, cartilage matrix protein | |
MATN1 | |
IgG | |
54 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title