Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Matriptase/ST14 Antibody, Novus Biologicals™
SDP

Catalog No. NBP156649 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP156649 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP156649 Supplier Novus Biologicals Supplier No. NBP156649
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Matriptase/ST14 Polyclonal specifically detects Matriptase/ST14 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Matriptase/ST14
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8WVC1
Gene Alias EC 3.4.21, HAI, Matriptase, Membrane-type serine protease 1, MT-SP1EC 3.4.21.109, prostamin, PRSS14, Serine protease 14, Serine protease TADG-15, SNC19MTSP1, suppression of tumorigenicity 14 (colon carcinoma), suppression of tumorigenicity 14 (colon carcinoma, matriptase, epithin), suppressor of tumorigenicity 14 protein, TADG15, TMPRSS14, tumor associated differentially expressed gene 15 protein, Tumor-associated differentially-expressed gene 15 protein
Gene Symbols ST14
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ST14(suppression of tumorigenicity 14 (colon carcinoma)) The peptide sequence was selected from the C terminal of ST14 (AAH18146). Peptide sequence SHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQIT.
Molecular Weight of Antigen 95 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 6768
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.