Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MAVS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23870425UL
Description
MAVS Polyclonal specifically detects MAVS in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
MAVS | |
Polyclonal | |
Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Q7Z434 | |
MAVS | |
This antibody was developed against a recombinant protein corresponding to amino acids: GSELSKPGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPDGGPRPQADRK | |
25 μL | |
Immune Dysfunction, Immune System Diseases, Immunology, Protein Kinase | |
57506 | |
Human | |
IgG |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CARD adapter inducing interferon beta, CARD adapter inducing interferon-beta, CARD adaptor inducing IFN-beta, CARDIF, DKFZp547C224, DKFZp666M015, FLJ27482, IFN-B promoter stimulator 1, Interferon beta promoter stimulator protein 1, interferon-beta promoter stimulator protein 1, IPS-1FLJ41962, IPS1MGC3260, KIAA1271FLJ35386, mitochondrial antiviral signaling protein, mitochondrial antiviral-signaling protein, mitochondrial viral signaling protein, Putative NF-kappa-B-activating protein 031N, virus-induced signaling adapter variant 1b, virus-induced signaling adaptor variant 1a, Virus-induced-signaling adapter, VISAFLJ38051 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction