Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MAZ Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | MAZ |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MAZ Polyclonal specifically detects MAZ in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| MAZ | |
| Polyclonal | |
| Rabbit | |
| Human | |
| MAZI, myc-associated zinc finger protein, MYC-associated zinc finger protein (purine-binding transcription factor), PUR1, Pur-1SAF-2, Purine-binding transcription factor, serum amyloid A activating factor 1, serum amyloid A activating factor 2, Transcription factor Zif87, ZF87SAF-1, Zif87, Zinc finger protein 801, zinc-finger protein, 87 kilodaltons, ZNF801SAF-3 | |
| MAZ | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 4150 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PTSTVAVAPVASALEKKTKSKGPYICALCAKEFKNGYNLRRHEA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title