Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MBD3L5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$343.50 - $573.00
Specifications
Antigen | MBD3L5 |
---|---|
Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
Applications | Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
MBD3L5 Polyclonal antibody specifically detects MBD3L5 in Human samples. It is validated for ImmunofluorescenceSpecifications
MBD3L5 | |
Immunofluorescence | |
Unconjugated | |
Rabbit | |
Human | |
MBD3-Like Protein 5, Methyl-CpG Binding Domain Protein 3 Like 5, Methyl-CpG Binding Domain Protein 3-Like 5, Putative Methyl-CpG-Binding Domain Protein 3-Like 5 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: GRFPAVAGGPTPGMGCQLPPPLSGQLVTPADIRRQARRVKKARERLAK | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
Polyclonal | |
Purified | |
RUO | |
PBS, pH 7.2, 40% glycerol | |
284428 | |
IgG | |
Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title