Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MBLAC2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP317391100UL
Description
MBLAC2 Polyclonal antibody specifically detects MBLAC2 in Human samples. It is validated for Western Blot, ImmunofluorescenceSpecifications
| MBLAC2 | |
| Polyclonal | |
| Western Blot 0.04 to 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
| DKFZp686P15118, EC 3.-, metallo-beta-lactamase domain containing 2, metallo-beta-lactamase domain-containing protein 2, MGC46734 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MSALEWYAHKSLGDGIFWIQERFYESGNRANIWLVRGSEQDVVIDTGLGLRSLPEYLYSSGLLQDREAKEDA | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 153364 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction