Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MBP Antibody (7D2), PerCP, Novus Biologicals™

Mouse Monoclonal Antibody
Supplier: Novus Biologicals NBP105204PCP
Description
MBP Monoclonal antibody specifically detects MBP in Human, Mouse, Rat, Porcine, Bovine, Equine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ ImmunofluorescenceSpecifications
MBP | |
Monoclonal | |
PerCP | |
PBS | |
Mouse | |
Affinity purified | |
RUO | |
Primary | |
Human, Mouse, Rat, Pig, Bovine | |
Purified |
Western Blot, Immunohistochemistry, Immunocytochemistry | |
7D2 | |
Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence | |
MGC99675, Myelin A1 protein, myelin basic protein, Myelin membrane encephalitogenic protein | |
Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG, amino acids 145-184 of the human 21.5kDa sequence. | |
0.1 mL | |
Hypoxia Signaling, Immune System Diseases, Immunology, Neuroscience, Neurotransmission, Oligodendrocyte Cell Markers, Phospho Specific, Stem Cell Markers | |
4155 | |
Store at 4C in the dark. | |
IgG1 |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction