Learn More
Description
Specifications
Specifications
| Antigen | MBP |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry |
| Classification | Monoclonal |
| Clone | 7D2 |
| Conjugate | PerCP |
| Dilution | Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence |
| Formulation | PBS |
| Gene Alias | MGC99675, Myelin A1 protein, myelin basic protein, Myelin membrane encephalitogenic protein |
| Host Species | Mouse |
| Immunogen | Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG, amino acids 145-184 of the human 21.5kDa sequence. |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
