Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MBP Antibody (CL2827), Novus Biologicals™
Mouse Monoclonal Antibody
$382.00
Specifications
| Antigen | MBP |
|---|---|
| Clone | CL2827 |
| Dilution | Western Blot 1 μg/mL, Immunohistochemistry 1:5000 - 1:10000, Immunocytochemistry/ Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:5000 - 1:10000 |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
Description
MBP Monoclonal antibody specifically detects MBP in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| MBP | |
| Western Blot 1 μg/mL, Immunohistochemistry 1:5000 - 1:10000, Immunocytochemistry/ Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:5000 - 1:10000 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| P02686 | |
| 4155 | |
| IgG1 | |
| Protein A purified |
| CL2827 | |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Mouse | |
| Hypoxia Signaling, Immune System Diseases, Immunology, Neuroscience, Neurotransmission, Oligodendrocyte Cell Markers, Stem Cell Markers | |
| PBS (pH 7.2), 40% Glycerol | |
| MGC99675, Myelin A1 protein, myelin basic protein, Myelin membrane encephalitogenic protein | |
| Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence DENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPM | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title