Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MCAT Antibody, Novus Biologicals™
SDP

Catalog No. p-200081350 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP258354 100 μL
NB403231 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP258354 Supplier Novus Biologicals Supplier No. NBP258354
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

MCAT Polyclonal specifically detects MCAT in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen MCAT
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias EC 2.3.1.39, fabD, FASN2C, malonyl CoA:ACP acyltransferase (mitochondrial), malonyl-CoA:acyl carrier protein transacylase, mitochondrial, malonyl-CoA-acyl carrier protein transacylase, mitochondrial, MCT[Acyl-carrier-protein] malonyltransferase, Mitochondrial malonyltransferase, MTMGC47838, NET62
Gene Symbols MCAT
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MPGQCSVLLFPGQGSQVVGMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHCQPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFAE
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 27349
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.