Novus Biologicals™ MCM10 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Supplier:  Novus Biologicals™ NBP257966PEP

Catalog No. NBP257966PE

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MCM10. Source: E.coli Amino Acid Sequence: REKLEEIDWVTFGVILKKVTPQSVNSGKTFSIWKLNDLRDLTQCVSLFLFGEVHKALWKTEQGTVVGILNANPMK The MCM10 Recombinant Protein Antigen is derived from E. coli. The MCM10 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 55388
• Common Name: MCM10 Recombinant Protein Antigen
• Formulation: PBS and 1M Urea, pH 7.4
• Gene Alias: CNA43homolog of yeast MCM10, DNA43, hsMCM10, MCM10 minichromosome maintenance deficient 10, MCM10 minichromosome maintenance deficient 10 (S. cerevisiae), MGC126776, minichromosome maintenance complex component 10, PRO2249, protein MCM10 homolog
• Label Type: Unlabeled
• Quantity: 100μL
• Source: E.coli

• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Symbol: MCM10
• Product Type: Recombinant Protein Antigen
• Regulatory Status: RUO
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50882. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For research use only.