Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MCM3AP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25850225UL
Description
MCM3AP Polyclonal specifically detects MCM3AP in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
MCM3AP | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
80 kDa MCM3-associated protein, FLJ44336, GANPFLJ45306, human mRNA for MCM3 import factor10Protein GANP, KIAA0572MAP80germinal center-associated nuclear protein, Map80, MCM3 import protein, MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) associated protein, MCM3 minichromosome maintenance deficient 3 associated protein, minichromosome maintenance complex component 3 associated protein, minichromosome maintenance deficient (S. cerevisiae) 3-associated protein, minichromosome maintenance deficient 3-associated protein | |
Rabbit | |
Affinity Purified | |
RUO | |
8888 | |
Human | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
MCM3AP | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RDWYDFVWNRTRGIRKDITQQHLCDPLTVSLIEKCTRFHIHCAHFMCEEPMSSFDAKINNENMTKCLQSLKEMYQDLRNKGVFCASE | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction