Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MCT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18784625UL
Description
MCT2 Polyclonal specifically detects MCT2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
MCT2 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
MCT 2, MCT2solute carrier family 16 (monocarboxylic acid transporters), member 7, monocarboxylate transporter 2, Solute carrier family 16 member 7, solute carrier family 16, member 7 (monocarboxylic acid transporter 2) | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
SLC16A7 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:GPNQTTSKSKNKTGKTEDDSSPKKIKTKKSTWEKVNKYLDFS | |
25 μL | |
Lipid and Metabolism | |
9194 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction