Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MCTP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | MCTP1 |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP159908
|
Novus Biologicals
NBP159908 |
100 μL |
Each of 1 for $436.00
|
|
Description
MCTP1 Polyclonal specifically detects MCTP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
MCTP1 | |
Unconjugated | |
RUO | |
Q6DN14-2 | |
79772 | |
Synthetic peptides corresponding to MCTP1(multiple C2 domains, transmembrane 1) The peptide sequence was selected from the middle region of MCTP1. Peptide sequence EVTVYDEDRDRSADFLGKVAIPLLSIQNGEQKAYVLKNKQLTGPTKGVIY. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ22344, multiple C2 and transmembrane domain-containing protein 1, multiple C2 domains, transmembrane 1, multiple C2-domains with two transmembrane regions 1 | |
MCTP1 | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title