MCTP1 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP159908	100 μL

Catalog No. NBP159908 Supplier Novus Biologicals Supplier No. NBP159908

Description

Rabbit Polyclonal Antibody

MCTP1 Polyclonal specifically detects MCTP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MCTP1
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: Q6DN14-2
• Gene Alias: FLJ22344, multiple C2 and transmembrane domain-containing protein 1, multiple C2 domains, transmembrane 1, multiple C2-domains with two transmembrane regions 1
• Gene Symbols: MCTP1
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to MCTP1(multiple C2 domains, transmembrane 1) The peptide sequence was selected from the middle region of MCTP1. Peptide sequence EVTVYDEDRDRSADFLGKVAIPLLSIQNGEQKAYVLKNKQLTGPTKGVIY.
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 79772
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Zebrafish: 100%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Mouse, Rat, Canine, Equine, Guinea Pig, Zebrafish
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG