Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MDH1B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | MDH1B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156446
|
Novus Biologicals
NBP156446 |
100 μL |
Each for $480.74
|
|
|||||
|
NBP15644620
|
Novus Biologicals
NBP15644620UL |
20 μL | N/A | N/A | N/A | ||||
Description
MDH1B Polyclonal specifically detects MDH1B in Human samples. It is validated for Western Blot.Specifications
| MDH1B | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| Q5I0G3 | |
| 130752 | |
| Synthetic peptides corresponding to MDH1B (malate dehydrogenase 1B, NAD (soluble)) The peptide sequence was selected from the middle region of MDH1B)(50ug). Peptide sequence YQSGHKDLVPDEEKNLAMSDAAEFPNQIPQTTFEKPQSLEFLNEFEGKTV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Human | |
| EC 1.1.1.-, FLJ25341, malate dehydrogenase 1B, NAD (soluble), putative malate dehydrogenase 1B, RP11-95H11 | |
| MDH1B | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title