Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MDMX Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | MDMX |
---|---|
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
MDMX Polyclonal specifically detects MDMX in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
MDMX | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
DKFZp781B1423, double minute 4 homolog, Double minute 4 protein, double minute 4, human homolog of; p53-binding protein, HDMX, Mdm2-like p53-binding protein, Mdm4 p53 binding protein homolog (mouse), Mdm4, transformed 3T3 cell double minute 4, p53 binding protein, Mdm4, transformed 3T3 cell double minute 4, p53 binding protein (mouse), MDM4-related protein 1, MDMXMGC132766, mouse double minute 4, human homolog of; p53-binding protein, MRP1, p53-binding protein Mdm4, protein Mdm4, Protein Mdmx | |
MDM4 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Rabbit | |
Apoptosis, DNA Repair, Signal Transduction | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
4194 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:SFSVKDPSPLYDMLRKNLVTLATATTDAAQTLALAQDHSMDIPSQDQLKQSAEESSTSRKRTTEDDIPTLP | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title