Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ MDMX Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579653
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579653 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579653 Supplier Invitrogen™ Supplier No. PA579653
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: mouse testis tissue, 22RV1 whole cell. IHC: human lung cancer tissue.

The MDM2 protein is the primary regulator of p53 protein stability. MDMX is an MDM2-related protein that inhibits MDM2-mediated degradation of p53 via distinct associations with MDM2. The gene that encodes MDMX (also designated MDM4) is a target for amplification in malignant gliomas. ARF interacts with MDMX to sequester MDMX within the nucleolus. This sequestration of MDMX by ARF results in an increase in p53 transactivation. In addition, expression of MDMX can reverse MDM2-targeted degradation of p53 while maintaining suppression of p53 transactivation. Like MDM2, MDMX also binds p73 and stabilizes the level of p73. Therefore, in striking contrast to p53, the half-life of p73 is increased by binding to MDM2.
TRUSTED_SUSTAINABILITY

Specifications

Antigen MDMX
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene MDM4
Gene Accession No. O15151, O35618
Gene Alias 4933417N07Rik; AA414968; AL023055; AU018793; AU021806; C85810; DKFZp781B1423; double minute 4 homolog; double minute 4 protein; double minute 4, human homolog of; p53-binding protein; HDMX; human homolog of; Mdm2-like p53-binding protein; MDM4; Mdm4 p53 binding protein homolog; MDM4 protein variant G; MDM4 protein variant Y; MDM4, p53 regulator; MDM4-related protein 1; Mdmx; MGC132766; MRP1; p53-binding protein Mdm4; Protein Mdm4; protein Mdmx; RP11-430C7.1; transformed mouse 3T3 cell double minute 4
Gene Symbols MDM4
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human MDMX (35-72aa KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 17248, 4194
Target Species Human, Mouse
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.