Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MDR3/ABCB4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $634.00
Specifications
| Antigen | MDR3/ABCB4 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
MDR3/ABCB4 Polyclonal specifically detects MDR3/ABCB4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| MDR3/ABCB4 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ABC21, ATP-binding cassette sub-family B member 4, ATP-binding cassette, sub-family B (MDR/TAP), member 4, EC 3.6.3, EC 3.6.3.44, MDR2, MDR3MDR2/3, multidrug resistance protein 3, multiple drug resistance 3, P glycoprotein 3/multiple drug resistance 3, PFIC-3, P-glycoprotein 3, P-glycoprotein-3/multiple drug resistance-3, PGY3GBD1 | |
| ABCB4 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| P21439 | |
| 5244 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LEAAKNGTAWRPTSAEGDFELGISSKQKRKKTKTVKMIGVLTLFRYSDWQD | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title