Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ME2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP154765
Description
ME2 Polyclonal specifically detects ME2 in Human samples. It is validated for Western Blot.Specifications
ME2 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
EC 1.1.1, EC 1.1.1.38, malate dehydrogenase, Malic enzyme 2, malic enzyme 2, NAD(+)-dependent, mitochondrial, NAD-dependent malic enzyme, mitochondrial, NAD-ME, ODS1, pyruvic-malic carboxylase | |
Rabbit | |
65 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
P23368 | |
ME2 | |
Synthetic peptides corresponding to ME2(malic enzyme 2, NAD(+)-dependent, mitochondrial) The peptide sequence was selected from the N terminal of ME2. Peptide sequence MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMG. | |
Affinity purified | |
RUO | |
4200 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction