Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MED17 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen MED17
Dilution Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation, Immunohistochemistry, Immunohistochemistry-Paraffin
Applications Western Blot, ChIP assay, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125527
View Documents
Novus Biologicals
NBP310313100UL
100 μg
Each for $320.71
Add to cart
 
NB125528
View Documents
Novus Biologicals
NBP31031325UL
25 μg
Each for $106.19
Add to cart
 
Description

Description

MED17 Polyclonal antibody specifically detects MED17 in Human samples. It is validated for Western Blot, ChIP assay, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications

Specifications

MED17
Western Blot, ChIP assay, Immunohistochemistry, Immunohistochemistry (Paraffin)
Purified
RUO
Human
Activator-recruited cofactor 77 kDa component, Cofactor required for Sp1 transcriptional activation subunit 6, cofactor required for Sp1 transcriptional activation, subunit 6, 77kDa, CRSP6FLJ10812, CRSP77cofactor required for Sp1 transcriptional activation, subunit 6 (77kD), DRIP77, DRIP80ARC77, mediator complex subunit 17Vitamin D3 receptor-interacting protein complex 80 kDa component, mediator of RNA polymerase II transcription subunit 17, Thyroid hormone receptor-associated protein complex 80 kDa component, Transcriptional coactivator CRSP77, Trap80, TRAP80CRSP complex subunit 6
The immunogen is a synthetic peptide directed towards the N terminal region of human MED17 (NP_004259). Peptide sequence AAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILG
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation, Immunohistochemistry, Immunohistochemistry-Paraffin
Unconjugated
Rabbit
Signal Transduction
PBS buffer, 2% sucrose
9440
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit