Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MED6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | MED6 |
---|---|
Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry |
Applications | Western Blot, Immunohistochemistry |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
MED6 Polyclonal specifically detects MED6 in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
MED6 | |
Western Blot, Immunohistochemistry | |
Unconjugated | |
Rabbit | |
Human | |
Activator-recruited cofactor 33 kDa component, ARC33, mediator complex subunit 6hMed6, mediator of RNA polymerase II transcription subunit 6, mediator of RNA polymerase II transcription, subunit 6 homolog, mediator of RNA polymerase II transcription, subunit 6 homolog (S. cerevisiae), NY-REN-28, Renal carcinoma antigen NY-REN-28 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MED6 (NP_005457). Peptide sequence KPGEKPVPVDQTKKEAEPIPETVKPEEKETTKNVQQTVSAKGPPEKRMRL | |
Affinity purified |
Western Blot 1.0 ug/ml, Immunohistochemistry | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
10001 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title