Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MED6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen MED6
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Applications Western Blot, Immunohistochemistry
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125870
View Documents
Novus Biologicals
NBP31048425UL
25 μg
Each for $106.19
Add to cart
 
NB125869
View Documents
Novus Biologicals
NBP310484100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

MED6 Polyclonal antibody specifically detects MED6 in Human samples. It is validated for Western Blot, Immunohistochemistry
Specifications

Specifications

MED6
Western Blot, Immunohistochemistry
Purified
RUO
PBS buffer, 2% sucrose
10001
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml, Immunohistochemistry
Unconjugated
Rabbit
Human
Activator-recruited cofactor 33 kDa component, ARC33, mediator complex subunit 6hMed6, mediator of RNA polymerase II transcription subunit 6, mediator of RNA polymerase II transcription, subunit 6 homolog, mediator of RNA polymerase II transcription, subunit 6 homolog (S. cerevisiae), NY-REN-28, Renal carcinoma antigen NY-REN-28
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MED6 (NP_005457). Peptide sequence KPGEKPVPVDQTKKEAEPIPETVKPEEKETTKNVQQTVSAKGPPEKRMRL
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit