Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MED7 Antibody, Novus Biologicals™

MED7 Antibody, Novus Biologicals™
SDP

Catalog No. NBP257915 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP257915 100 μL
NB403342 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP257915 Supplier Novus Biologicals Supplier No. NBP257915
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

MED7 Polyclonal specifically detects MED7 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen MED7
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias Activator-recruited cofactor 34 kDa component, Cofactor required for Sp1 transcriptional activation subunit 9, cofactor required for Sp1 transcriptional activation, subunit 9 (33kD), cofactor required for Sp1 transcriptional activation, subunit 9, 33kDa, CRSP33CRSP complex subunit 9, CRSP9hMED7, mediator complex subunit 7ARC34, mediator of RNA polymerase II transcription subunit 7, MGC12284, RNA polymerase transcriptional regulation mediator subunit 7 homolog, Transcriptional coactivator CRSP33
Gene Symbols MED7
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMI
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 9443
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.