MED9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB437268	Novus Biologicals NBP23163925UL	25 μL
NBP231639	Novus Biologicals NBP231639	0.1 mL

Description

MED9 Polyclonal specifically detects MED9 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MED9
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: FLJ10193mediator of RNA polymerase II transcription, subunit 9 homolog, MED25mediator of RNA polymerase II transcription subunit 9, mediator complex subunit 9MGC138234, mediator of RNA polymerase II transcription, subunit 9 homolog (S. cerevisiae), mediator subunit 25
• Gene Symbols: MED9
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q9NWA0
• Gene ID (Entrez): 55090
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MASAGVAAGRQAEDVLPPTSDQPLPDTKPLPPP
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only