Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
mediator of cell motility 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | mediator of cell motility 1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
mediator of cell motility 1 Polyclonal specifically detects mediator of cell motility 1 in Human samples. It is validated for Western Blot.Specifications
mediator of cell motility 1 | |
Polyclonal | |
Rabbit | |
Q9Y316 | |
51072 | |
Synthetic peptides corresponding to MEMO1(mediator of cell motility 1) The peptide sequence was selected from the middle region of MEMO1. Peptide sequence AMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCH. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C21orf19-like protein, C2orf4DKFZp434I0135, CGI-27, FLJ25031, HCV NS5A-transactivated protein 7, Hepatitis C virus NS5A-transactivated protein 7, mediator of cell motility 1, Mediator of ErbB2-driven cell motility 1, memo-1, MEMOchromosome 2 open reading frame 4, NS5ATP7, protein MEMO1 | |
MEMO1 | |
IgG | |
34 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title