mediator of cell motility 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25823625UL

Catalog No. NB403253

Description

mediator of cell motility 1 Polyclonal specifically detects mediator of cell motility 1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: mediator of cell motility 1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: C21orf19-like protein, C2orf4DKFZp434I0135, CGI-27, FLJ25031, HCV NS5A-transactivated protein 7, Hepatitis C virus NS5A-transactivated protein 7, mediator of cell motility 1, Mediator of ErbB2-driven cell motility 1, memo-1, MEMOchromosome 2 open reading frame 4, NS5ATP7, protein MEMO1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: MEMO1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSITRRI
• Quantity: 25 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 51072
• Target Species: Human
• Isotype: IgG

For Research Use Only