Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MEF2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25853925UL
Description
MEF2A Polyclonal specifically detects MEF2A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
MEF2A | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
ADCAD1, MADS box transcription enhancer factor 2, polypeptide A (myocyte enhancerfactor 2A), MEF2, myocyte enhancer factor 2A, myocyte-specific enhancer factor 2A, RSRFC4, RSRFC9, Serum response factor-like protein 1 | |
Rabbit | |
Affinity Purified | |
RUO | |
4205 | |
Human | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
MEF2A | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DLSALQGFNSPGMLSLGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNISIKSEP | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction