Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ MEFV Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579662
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579662 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579662 Supplier Invitrogen™ Supplier No. PA579662
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Spleen Tissue, Rat Lung Tissue, HEPA whole cell.

This gene encodes a protein, also known as pyrin or marenostrin, that is an important modulator of innate immunity. Mutations in this gene are associated with Mediterranean fever, a hereditary periodic fever syndrome.
TRUSTED_SUSTAINABILITY

Specifications

Antigen MEFV
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene MEFV
Gene Accession No. O15553, Q9JJ25
Gene Alias FMF; HGNC:6998; Marenostrin; Mediterranean fever; MEF; MEFV; MGC126560; MGC126586; Pyrin; TRIM20
Gene Symbols MEFV
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human MEFV (5-39aa PSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSR).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4210, 58923
Target Species Human, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.