Invitrogen™ MEK3 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579626

Catalog No. PIPA579626

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, rat kidney tissue, mouse NIH/3T3 whole cell. IHC: human liver cancer tissue, human ovarian cancer tissue. ICC/IF: CACO-2 cell. Flow: CACO-2 cell.

MAP2K3 (MEK3) is a dual-specificity protein kinase which acts in cellular signal transduction pathways, and is necessary for the expression of glucose transporter. It phosphorylates and thus activates MAPK14/p38-MAPK. This kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. The inhibition of this kinase is involved in the pathogenesis of Yersina pseudotuberculosis. Multiple alternatively spliced transcript variants that encode distinct isoforms have been reported for MEK3.

Specifications

• Antigen: MEK3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: MAP2K3
• Gene Alias: AW212142; dual specificity mitogen-activated protein kinase kinase 3; EC 2.7.12.2; MAP kinase kinase 3; Map2k3; MAPK/ERK kinase 3; MAPKK 3; MAPKK3; MEK 3; Mek3; mitogen activated protein kinase kinase 3; mitogen-activated protein kinase kinase 3; Mkk3; mMKK3b; Prkmk3; protein kinase, mitogen-activated, kinase 3; SAPK kinase 2; SAPKK2; SAPKK-2; SKK2; Stress-activated protein kinase kinase 2
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 26397, 303200, 5606
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: O09110, P46734
• Gene Symbols: MAP2K3
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MEK3 (311-347aa AERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov