Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MEKK1 Antibody (2F6) - IHC-Prediluted, Novus Biologicals™

Mouse Monoclonal Antibody
Supplier: Novus Biologicals NBP248208
Description
MEKK1 Monoclonal specifically detects MEKK1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
MEKK1 | |
Monoclonal | |
Unconjugated | |
10mM PBS and 0.05% BSA with 0.05% Sodium Azide | |
MAP3K1 | |
Partial recombinant MEKK1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK) (Uniprot: Q13233) | |
7 mL | |
Angiogenesis, Breast Cancer, Cancer, Lipid and Metabolism, MAP Kinase Signaling, mTOR Pathway, Protein Kinase, Signal Transduction, Tyrosine Kinases | |
4214 | |
Human | |
Purified |
Immunohistochemistry (Paraffin) | |
2F6 | |
Immunohistochemistry-Paraffin | |
Map3k1, MAPK/ERK kinase kinase 1, MAPKKK1MAP/ERK kinase kinase 1, MEK kinase 1, MEKK1EC 2.7.11.25, MEKKMEKK 1, mitogen-activated protein kinase kinase kinase 1 | |
Mouse | |
Protein A or G purified | |
RUO | |
Primary | |
Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NF B pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination. | |
Store at 4C. | |
IgG2a κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction