Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MEKK1 Antibody (2F6), Novus Biologicals™

MEKK1 Antibody (2F6), Novus Biologicals™
SDP

Catalog No. NBP24440501 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.02 mg
0.1 mg
0.2 mg
3 product options available for selection
Product selection table with 3 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP24440501 0.1 mg
NBP24440500 0.02 mg
NBP24440502 0.2 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 3 options available.
3 options
Catalog No. NBP24440501 Supplier Novus Biologicals Supplier No. NBP2444050.1MG
Only null left
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

Ensure accurate, reproducible results in Western Blot, Flow Cytometry, Immunohistochemistry (Paraffin), Immunofluorescence

MEKK1 Monoclonal specifically detects MEKK1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen MEKK1
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Immunofluorescence
Classification Monoclonal
Clone 2F6
Concentration 0.2mg/mL
Conjugate Unconjugated
Dilution Flow Cytometry 0.5 - 1 ug/million cells in 0.1 ml, Immunohistochemistry-Paraffin 0.5 - 1.0 ug/ml, Immunofluorescence 1 - 2 ug/ml
Formulation 10mM PBS and 0.05% BSA with 0.05% Sodium Azide
Gene Accession No. Q13233
Gene Alias MAPK/ERK kinase kinase 1, MAPKKK1MAP/ERK kinase kinase 1, MEK kinase 1, MEKK1EC 2.7.11.25, MEKKMEKK 1, mitogen-activated protein kinase kinase kinase 1
Gene Symbols MAP3K1
Host Species Mouse
Immunogen Partial recombinant MAP3K1 (aa1211-1310) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)
Purification Method Protein A or G purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Angiogenesis, Breast Cancer, Cancer, Lipid and Metabolism, MAP Kinase Signaling, mTOR Pathway, Protein Kinase, Signal Transduction, Tyrosine Kinases
Primary or Secondary Primary
Gene ID (Entrez) 4214
Test Specificity Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NF B pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.
Target Species Human
Content And Storage Store at 4C.
Form Purified
Isotype IgG2a κ
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.