MEKK1 Antibody (2F6), Alexa Fluor™ 700, Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP247810AF700

Catalog No. NB247810700

Description

MEKK1 Monoclonal specifically detects MEKK1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MEKK1
• Classification: Monoclonal
• Conjugate: Alexa Fluor 700
• Formulation: 50mM Sodium Borate with 0.05% Sodium Azide
• Gene Symbols: MAP3K1
• Immunogen: Partial recombinant MEKK1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK) (Uniprot: Q13233)
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NF B pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.
• Content And Storage: Store at 4C in the dark.
• Isotype: IgG2a κ

• Applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Clone: 2F6
• Dilution: Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunofluorescence
• Gene Alias: Map3k1, MAPK/ERK kinase kinase 1, MAPKKK1MAP/ERK kinase kinase 1, MEK kinase 1, MEKK1EC 2.7.11.25, MEKKMEKK 1, mitogen-activated protein kinase kinase kinase 1
• Host Species: Mouse
• Purification Method: Protein A or G purified
• Research Discipline: Angiogenesis, Breast Cancer, Cancer, Lipid and Metabolism, MAP Kinase Signaling, mTOR Pathway, Phospho Specific, Protein Kinase, Signal Transduction, Tyrosine Kinases
• Gene ID (Entrez): 4214
• Target Species: Human
• Form: Purified